SCOPe 2.08: Domain d2yobb_: 2yob B:

Lineage for d2yobb_ (2yob B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)

6. Protein automated matches [190399] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189951] (11 PDB entries)

8. Domain d2yobb_: 2yob B: [228745]
   automated match to d3kgwb_
   complexed with btb, gol, plp, so4

Details for d2yobb_

PDB Entry: 2yob, 1.9 Å

PDB Description: High resolution AGXT_M structure

PDB Compounds: (B:) Serine--pyruvate aminotransferase

SCOPe Domain Sequences for d2yobb_:

Sequence; same for both SEQRES and ATOM records:

>d2yobb_ c.67.1.3 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hkllvtppkallkplsipnqlllgpgpsnlpprimaagglqmigsmskdmyqimdeikeg
iqyvfqtrnpltlvisgsghcaleaalvnvlepgdsflvgangiwgqravdigerigarv
hpmtkdpgghytlqeveeglaqhkpvllflthgesstgvlqpldgfgelchrykclllvd
svaslggtplymdrqgidilysgsqkalnappgtslisfsdkakkkmysrktkpfsfyld
ikwlanfwgcddqprmyhhtipvislyslreslaliaeqglenswrqhreaaaylhgrlq
alglqlfvkdpalrlptvttvavpagydwrdivsyvmdhfdieimgglgpstgkvlrigl
lgcnatrenvdrvtealraalvaqa

Timeline for d2yobb_:

• d2yobb_ first appeared in SCOPe 2.03
  
• d2yobb_ appears in SCOPe 2.07