Lineage for d3wc4a_ (3wc4 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142537Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2142538Protein automated matches [190965] (26 species)
    not a true protein
  7. 2142542Species Clitoria ternatea [TaxId:43366] [228739] (5 PDB entries)
  8. 2142543Domain d3wc4a_: 3wc4 A: [228740]
    automated match to d3hbfa_
    complexed with act, gol

Details for d3wc4a_

PDB Entry: 3wc4 (more details), 1.85 Å

PDB Description: Crystal structure of UDP-glucose: anthocyanidin 3-O-glucosyltransferase from Clitoria ternatea
PDB Compounds: (A:) UDP-glucose:anthocyanidin 3-O-glucosyltransferase

SCOPe Domain Sequences for d3wc4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wc4a_ c.87.1.0 (A:) automated matches {Clitoria ternatea [TaxId: 43366]}
mknkqhvaifpfpfgshlppllnlvlklahiapntsfsfigthssnaflftkrhipnnir
vftisdgipeghvpannpiekldlflstgpdnlrkgielavaetkqsvtciiadafvtss
llvaqtlnvpwiafwpnvscslslyfnidlirdkcskdaknatldflpglsklrvedvpq
dmldvgeketlfsrtlnslgvvlpqakavvvnffaeldpplfvkymrsklqsllyvvplp
cpqlllpeidsngclswldskssrsvayvcfgtvvspppqevvavaealeesgfpfvwal
kesllsilpkgfvertstrgkvvswvpqshvlshgsvgvfvthcgansvmesvsngvpmi
crpffgdqgiaarviqdiwevgvivegkvftkngfvkslnlilvqedgkkirdnalkvkq
ivqdavgphgqaaedfntlvevisss

SCOPe Domain Coordinates for d3wc4a_:

Click to download the PDB-style file with coordinates for d3wc4a_.
(The format of our PDB-style files is described here.)

Timeline for d3wc4a_: