SCOP 1.73: Domain d1bxua_: 1bxu A:

Lineage for d1bxua_ (1bxu A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (14 species)

7. Species Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId:1143] [49520] (2 PDB entries)

8. Domain d1bxua_: 1bxu A: [22874]
   complexed with cu

Details for d1bxua_

PDB Entry: 1bxu, 1.9 Å

PDB Description: oxidized plastocyanin from synechococcus sp.

PDB Compounds: (A:) plastocyanin

SCOP Domain Sequences for d1bxua_:

Sequence; same for both SEQRES and ATOM records:

>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]}
qtvaikmgadngmlafepstieiqagdtvqwvnnklaphnvvvegqpelshkdlafspge
tfeatfsepgtytyycephrgagmvgkivvq

Timeline for d1bxua_:

• d1bxua_ first appeared (with stable ids) in SCOP 1.55
  
• d1bxua_ appears in SCOP 1.71
  
• d1bxua_ appears in SCOP 1.75
  
• d1bxua_ appears in the current release, SCOPe 2.08