Lineage for d1bxua_ (1bxu A:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 55934Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 56083Protein Plastocyanin [49507] (14 species)
  7. 56097Species Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId:1143] [49520] (2 PDB entries)
  8. 56098Domain d1bxua_: 1bxu A: [22874]

Details for d1bxua_

PDB Entry: 1bxu (more details), 1.9 Å

PDB Description: oxidized plastocyanin from synechococcus sp.

SCOP Domain Sequences for d1bxua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942}
qtvaikmgadngmlafepstieiqagdtvqwvnnklaphnvvvegqpelshkdlafspge
tfeatfsepgtytyycephrgagmvgkivvq

SCOP Domain Coordinates for d1bxua_:

Click to download the PDB-style file with coordinates for d1bxua_.
(The format of our PDB-style files is described here.)

Timeline for d1bxua_: