Lineage for d4n8pa1 (4n8p A:39-155)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2745429Species Ornithorhynchus anatinus [TaxId:9258] [228732] (1 PDB entry)
  8. 2745430Domain d4n8pa1: 4n8p A:39-155 [228733]
    Other proteins in same PDB: d4n8pa2
    automated match to d3oskb_
    complexed with gol, nag

Details for d4n8pa1

PDB Entry: 4n8p (more details), 2.3 Å

PDB Description: crystal structure of a strand swapped ctla-4 from duckbill platypus [psi-nysgrc-012711]
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d4n8pa1:

Sequence, based on SEQRES records: (download)

>d4n8pa1 b.1.1.1 (A:39-155) automated matches {Ornithorhynchus anatinus [TaxId: 9258]}
lqvtqprvvlasmkgvaslaceyeftgkakeirvtlirqtgnefhevcassftteyepfv
stediechvqpsennvtltlmglkatdtglyvcrvelmypppyymglgngtqiyvve

Sequence, based on observed residues (ATOM records): (download)

>d4n8pa1 b.1.1.1 (A:39-155) automated matches {Ornithorhynchus anatinus [TaxId: 9258]}
lqvtqprvvlasmkgvaslaceyeftgkakeirvtlirqtgnefhevcassftteyepfd
iechvqpsennvtltlmglkatdtglyvcrvelmypppyymglgngtqiyvve

SCOPe Domain Coordinates for d4n8pa1:

Click to download the PDB-style file with coordinates for d4n8pa1.
(The format of our PDB-style files is described here.)

Timeline for d4n8pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4n8pa2