SCOPe 2.08: Domain d4n8pa1: 4n8p A:39-155

Lineage for d4n8pa1 (4n8p A:39-155)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Ornithorhynchus anatinus [TaxId:9258] [228732] (1 PDB entry)

8. Domain d4n8pa1: 4n8p A:39-155 [228733]
   Other proteins in same PDB: d4n8pa2
   automated match to d3oskb_
   complexed with gol, nag

Details for d4n8pa1

PDB Entry: 4n8p, 2.3 Å

PDB Description: crystal structure of a strand swapped ctla-4 from duckbill platypus [psi-nysgrc-012711]

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d4n8pa1:

Sequence, based on SEQRES records:

>d4n8pa1 b.1.1.1 (A:39-155) automated matches {Ornithorhynchus anatinus [TaxId: 9258]}
lqvtqprvvlasmkgvaslaceyeftgkakeirvtlirqtgnefhevcassftteyepfv
stediechvqpsennvtltlmglkatdtglyvcrvelmypppyymglgngtqiyvve

Sequence, based on observed residues (ATOM records):

>d4n8pa1 b.1.1.1 (A:39-155) automated matches {Ornithorhynchus anatinus [TaxId: 9258]}
lqvtqprvvlasmkgvaslaceyeftgkakeirvtlirqtgnefhevcassftteyepfd
iechvqpsennvtltlmglkatdtglyvcrvelmypppyymglgngtqiyvve

Timeline for d4n8pa1:

• d4n8pa1 first appeared in SCOPe 2.03, called d4n8pa_
  
• d4n8pa1 appears in SCOPe 2.07