Lineage for d1i0wa_ (1i0w A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 11048Protein Plastocyanin [49507] (14 species)
  7. 11056Species Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId:1148] [49519] (3 PDB entries)
  8. 11059Domain d1i0wa_: 1i0w A: [22873]

Details for d1i0wa_

PDB Entry: 1i0w (more details)

PDB Description: solution structure of oxidized paramagnetic cu(ii) plastocyanin from synechocystis pcc6803

SCOP Domain Sequences for d1i0wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1i0wa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803}
anatvkmgsdsgalvfepstvtikageevkwvnnklsphnivfaadgvdadtaaklshkg
lafaagesftstftepgtytyycephrgagmvgkvvvd

SCOP Domain Coordinates for d1i0wa_:

Click to download the PDB-style file with coordinates for d1i0wa_.
(The format of our PDB-style files is described here.)

Timeline for d1i0wa_: