SCOPe 2.03: Domain d4n5fa1: 4n5f A:0-228

Lineage for d4n5fa1 (4n5f A:0-228)

1. Root: SCOPe 2.03

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
   2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology

4. Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families)
   flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)

5. Family e.6.1.0: automated matches [227203] (1 protein)
   not a true family

6. Protein automated matches [226934] (14 species)
   not a true protein

7. Species Burkholderia cenocepacia [TaxId:216591] [228724] (1 PDB entry)

8. Domain d4n5fa1: 4n5f A:0-228 [228728]
   Other proteins in same PDB: d4n5fa2, d4n5fb2
   automated match to d1ukwa2
   complexed with fda, unx

Details for d4n5fa1

PDB Entry: 4n5f, 2.2 Å

PDB Description: Crystal Structure of a Putative acyl-CoA dehydrogenase with bound FADH2 from Burkholderia cenocepacia J2315

PDB Compounds: (A:) putative acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4n5fa1:

Sequence; same for both SEQRES and ATOM records:

>d4n5fa1 e.6.1.0 (A:0-228) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
hmdelytedqrmirdaarafatemlapnaaqwdhdahlpdaivaqlgelgllgmivpqel
ggsytdyvayalameevaagdaacatmmsvhnsvgcgpilgfgtpaqkdrwladmaagrv
igafcltephagseannlrtraelrdgqwvlngakqfvtngqragvaivfamtdpeagkr
gisaflvptdtpgfivgkpekkmgirasdtcpitfencaipednllgnr

Timeline for d4n5fa1:

• d4n5fa1 is new in SCOPe 2.03-stable
  
• d4n5fa1 appears in SCOPe 2.04
  
• d4n5fa1 appears in the current release, SCOPe 2.08