Lineage for d4n5fb2 (4n5f B:229-377)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708519Species Burkholderia cenocepacia [TaxId:216591] [228726] (1 PDB entry)
  8. 2708521Domain d4n5fb2: 4n5f B:229-377 [228727]
    Other proteins in same PDB: d4n5fa1, d4n5fa3, d4n5fb1, d4n5fb3
    automated match to d1ukwa1
    complexed with fda, unx

Details for d4n5fb2

PDB Entry: 4n5f (more details), 2.2 Å

PDB Description: Crystal Structure of a Putative acyl-CoA dehydrogenase with bound FADH2 from Burkholderia cenocepacia J2315
PDB Compounds: (B:) putative acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4n5fb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n5fb2 a.29.3.0 (B:229-377) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
geglkialsnleggrigiaaqalgiaraafdkarryagervqfgkpiaehqaiqqkladm
avqinaarllvhhaaklrtaglpclseasqaklfasemaervcsdaiqihggygylvdye
verhyrdaritqiyegtsevqrmviarql

SCOPe Domain Coordinates for d4n5fb2:

Click to download the PDB-style file with coordinates for d4n5fb2.
(The format of our PDB-style files is described here.)

Timeline for d4n5fb2: