Lineage for d4n5fb1 (4n5f B:0-228)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1950935Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 1950936Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 1951081Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 1951082Protein automated matches [226934] (20 species)
    not a true protein
  7. 1951110Species Burkholderia cenocepacia [TaxId:216591] [228724] (1 PDB entry)
  8. 1951112Domain d4n5fb1: 4n5f B:0-228 [228725]
    Other proteins in same PDB: d4n5fa2, d4n5fb2
    automated match to d1ukwa2
    complexed with fda, unx

Details for d4n5fb1

PDB Entry: 4n5f (more details), 2.2 Å

PDB Description: Crystal Structure of a Putative acyl-CoA dehydrogenase with bound FADH2 from Burkholderia cenocepacia J2315
PDB Compounds: (B:) putative acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4n5fb1:

Sequence, based on SEQRES records: (download)

>d4n5fb1 e.6.1.0 (B:0-228) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
hmdelytedqrmirdaarafatemlapnaaqwdhdahlpdaivaqlgelgllgmivpqel
ggsytdyvayalameevaagdaacatmmsvhnsvgcgpilgfgtpaqkdrwladmaagrv
igafcltephagseannlrtraelrdgqwvlngakqfvtngqragvaivfamtdpeagkr
gisaflvptdtpgfivgkpekkmgirasdtcpitfencaipednllgnr

Sequence, based on observed residues (ATOM records): (download)

>d4n5fb1 e.6.1.0 (B:0-228) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
hmdelytedqrmirdaarafatemlapnaaqwdhdahlpdaivaqlgelgllgmivpqel
ggsytdyvayalameevaagdaacatmmsvhnsvgcgpilgfgtpaqkdrwladmaagrv
igafcltephlrtraelrdwvlngakqfvtngqragvaivfamtdpeagkrgisaflvpt
dtpgfivgkpekkmgirasdtcpitfencaipednllgnr

SCOPe Domain Coordinates for d4n5fb1:

Click to download the PDB-style file with coordinates for d4n5fb1.
(The format of our PDB-style files is described here.)

Timeline for d4n5fb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4n5fb2