SCOPe 2.05: Domain d4n42a_: 4n42 A:

Lineage for d4n42a_ (4n42 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (72 species)
   not a true protein

7. Species Scadoxus multiflorus [TaxId:82246] [188826] (7 PDB entries)

8. Domain d4n42a_: 4n42 A: [228722]
   automated match to d3o9na_
   complexed with po4

Details for d4n42a_

PDB Entry: 4n42, 2.2 Å

PDB Description: Crystal structure of allergen protein scam1 from Scadoxus multiflorus

PDB Compounds: (A:) Xylanase and alpha-amylase inhibitor protein isoform III

SCOPe Domain Sequences for d4n42a_:

Sequence; same for both SEQRES and ATOM records:

>d4n42a_ c.1.8.0 (A:) automated matches {Scadoxus multiflorus [TaxId: 82246]}
gnldiavywgqnfdersleatcdsgnyayviigflntfgggqtpaldisghspsglepqi
khcqsknvkvllsiggpagpysldsrsdandlavylfnnfllppghsennpfgnavldgi
dfhiehggpsqyqllanilssfrlkgtefaltaapqcvypdpnlgtvinsatfdaiwvqf
ynnpqcsyssgnaealmnawrewsmkartkkvflgfpahpdaagsgymppakvkfhvfpa
akksykfggimlwdsywdtvsqfsnkilgdgv

Timeline for d4n42a_:

• d4n42a_ first appeared in SCOPe 2.03
  
• d4n42a_ appears in SCOPe 2.04
  
• d4n42a_ appears in SCOPe 2.06
  
• d4n42a_ appears in the current release, SCOPe 2.08