SCOPe 2.06: Domain d4mswc_: 4msw C:

Lineage for d4mswc_ (4msw C:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (2 species)

7. Species Streptomyces lividans [TaxId:1916] [161074] (20 PDB entries)

8. Domain d4mswc_: 4msw C: [228720]
   Other proteins in same PDB: d4mswa1, d4mswa2, d4mswb1, d4mswb2
   automated match to d1s5hc_
   complexed with dga, k; mutant

Details for d4mswc_

PDB Entry: 4msw, 2.06 Å

PDB Description: y78 ester mutant of kcsa in high k+

PDB Compounds: (C:) pH-gated potassium channel KcsA

SCOPe Domain Sequences for d4mswc_:

Sequence; same for both SEQRES and ATOM records:

>d4mswc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgxgdl
ypvtlwgrlvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d4mswc_:

• d4mswc_ first appeared in SCOPe 2.03
  
• d4mswc_ appears in SCOPe 2.05
  
• d4mswc_ appears in SCOPe 2.07
  
• d4mswc_ appears in the current release, SCOPe 2.08