Lineage for d4mjja_ (4mjj A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2773072Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 2773073Protein automated matches [190497] (4 species)
    not a true protein
  7. 2773076Species Human (Homo sapiens) [TaxId:9606] [188711] (30 PDB entries)
  8. 2773100Domain d4mjja_: 4mjj A: [228717]
    automated match to d2chda_

Details for d4mjja_

PDB Entry: 4mjj (more details), 2 Å

PDB Description: Crystal structure of the C2A domain of DOC2A
PDB Compounds: (A:) Double C2-like domain-containing protein alpha

SCOPe Domain Sequences for d4mjja_:

Sequence, based on SEQRES records: (download)

>d4mjja_ b.7.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
algtlefdllydrasctlhcsilrakglkpmdfngladpyvklhllpgackanklktktq
rntlnpvwnedltysgitdddithkvlriavcdedklshnefigeirvplrrlkpsqkkh
fniclerq

Sequence, based on observed residues (ATOM records): (download)

>d4mjja_ b.7.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
algtlefdllydrasctlhcsilrakglkpdpyvklhllpgackanklktktqrntlnpv
wnedltysgitdddithkvlriavcdedefigeirvplrrlkpsqkkhfniclerq

SCOPe Domain Coordinates for d4mjja_:

Click to download the PDB-style file with coordinates for d4mjja_.
(The format of our PDB-style files is described here.)

Timeline for d4mjja_: