![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.83: Aha1/BPI domain-like [55393] (2 superfamilies) core: [beta]-alpha-beta(5)-alpha; 2 layers: alpha/beta; antiparallel beta-sheet, meander |
![]() | Superfamily d.83.1: Bactericidal permeability-increasing protein, BPI [55394] (2 families) ![]() duplication: consists of two clear structural repeats of this fold also containing an extra C-terminal beta-hairpin |
![]() | Family d.83.1.0: automated matches [228706] (1 protein) not a true family |
![]() | Protein automated matches [228707] (1 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [228708] (1 PDB entry) |
![]() | Domain d4m4db2: 4m4d B:241-481 [228711] automated match to d1ewfa2 complexed with nag, pc1 |
PDB Entry: 4m4d (more details), 2.91 Å
SCOPe Domain Sequences for d4m4db2:
Sequence, based on SEQRES records: (download)
>d4m4db2 d.83.1.0 (B:241-481) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qvldvmfkgeifnrnhrspvatptptmslpedskqmvyfaisdyafniasrvyhqagyln fsitddmlphdsgirlntkafrpftpqiykkypdmklellgtvvsapilnvspgnlslap qmeiegfvilptsarepvfrlgvvtnvfasltfnnskvtgmlhpdkaqvrlieskvgmfn vnlfqaflnyyllnslypdvnaelaqgfplplprhiqlhdldfqirkdflylganvqymr v
>d4m4db2 d.83.1.0 (B:241-481) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qvldvmfkgeifnhrspvatptptmslpedskqmvyfaisdyaylnfsitddmlphdsgi rlntkafrpftpqiykkypdmklellgtvvsapilnvspgnlslapqmeiegfvilptsa repvfrlgvvtnvfasltfnnskvtgmlhpdkaqvrlieskvgmfnvnlfqaflnyylln slypdvnaelaqgfplplprhiqlhdldfqirkdflylganvqymrv
Timeline for d4m4db2: