SCOPe 2.08: Domain d1pcsa_: 1pcs A:

Lineage for d1pcsa_ (1pcs A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (17 species)

7. Species Synechocystis sp. PCC 6803 [TaxId:1148] [49519] (6 PDB entries)

8. Domain d1pcsa_: 1pcs A: [22871]
   complexed with cu; mutant

Details for d1pcsa_

PDB Entry: 1pcs, 2.15 Å

PDB Description: the 2.15 a crystal structure of a triple mutant plastocyanin from the cyanobacterium synechocystis sp. pcc 6803

PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d1pcsa_:

Sequence; same for both SEQRES and ATOM records:

>d1pcsa_ b.6.1.1 (A:) Plastocyanin {Synechocystis sp. PCC 6803 [TaxId: 1148]}
anatvkmgsdsgalvfepstvtikageevkwvnnklsphnivfdadgvpadtaaklshkg
llfaagesftstftepgtytyycephrgagmvgkvvve

Timeline for d1pcsa_:

• d1pcsa_ first appeared (with stable ids) in SCOP 1.55, called d1pcs__
  
• d1pcsa_ appears in SCOPe 2.07