Lineage for d1bawc_ (1baw C:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 106628Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 106629Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 106630Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 106803Protein Plastocyanin [49507] (14 species)
  7. 106807Species Cyanobacterium (Phormidium laminosum) [TaxId:32059] [49518] (1 PDB entry)
  8. 106810Domain d1bawc_: 1baw C: [22870]

Details for d1bawc_

PDB Entry: 1baw (more details), 2.8 Å

PDB Description: plastocyanin from phormidium laminosum

SCOP Domain Sequences for d1bawc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bawc_ b.6.1.1 (C:) Plastocyanin {Cyanobacterium (Phormidium laminosum)}
etftvkmgadsgllqfepanvtvhpgdtvkwvnnklpphnilfddkqvpgaskeladkls
hsqlmfspgesyeitfssdfpagtytyycaphrgagmvgkitveg

SCOP Domain Coordinates for d1bawc_:

Click to download the PDB-style file with coordinates for d1bawc_.
(The format of our PDB-style files is described here.)

Timeline for d1bawc_: