SCOP 1.59: Domain d1bawb_: 1baw B:

Lineage for d1bawb_ (1baw B:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.6: Cupredoxins [49502] (1 superfamily)

4. Superfamily b.6.1: Cupredoxins [49503] (4 families)

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)

6. Protein Plastocyanin [49507] (14 species)

7. Species Cyanobacterium (Phormidium laminosum) [TaxId:32059] [49518] (1 PDB entry)

8. Domain d1bawb_: 1baw B: [22869]

Details for d1bawb_

PDB Entry: 1baw, 2.8 Å

PDB Description: plastocyanin from phormidium laminosum

SCOP Domain Sequences for d1bawb_:

Sequence; same for both SEQRES and ATOM records:

>d1bawb_ b.6.1.1 (B:) Plastocyanin {Cyanobacterium (Phormidium laminosum)}
etftvkmgadsgllqfepanvtvhpgdtvkwvnnklpphnilfddkqvpgaskeladkls
hsqlmfspgesyeitfssdfpagtytyycaphrgagmvgkitveg

Timeline for d1bawb_:

• d1bawb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bawb_ appears in SCOP 1.57
  
• d1bawb_ appears in SCOP 1.61
  
• d1bawb_ appears in the current release, SCOPe 2.08