Lineage for d1bawa_ (1baw A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 11048Protein Plastocyanin [49507] (14 species)
  7. 11052Species Cyanobacterium (Phormidium laminosum) [TaxId:32059] [49518] (1 PDB entry)
  8. 11053Domain d1bawa_: 1baw A: [22868]

Details for d1bawa_

PDB Entry: 1baw (more details), 2.8 Å

PDB Description: plastocyanin from phormidium laminosum

SCOP Domain Sequences for d1bawa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bawa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Phormidium laminosum)}
etftvkmgadsgllqfepanvtvhpgdtvkwvnnklpphnilfddkqvpgaskeladkls
hsqlmfspgesyeitfssdfpagtytyycaphrgagmvgkitveg

SCOP Domain Coordinates for d1bawa_:

Click to download the PDB-style file with coordinates for d1bawa_.
(The format of our PDB-style files is described here.)

Timeline for d1bawa_: