SCOPe 2.05: Domain d4lk7a_: 4lk7 A:

Lineage for d4lk7a_ (4lk7 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.16: PA-IL, galactose-binding lectin 1 [82022] (1 protein)
   a truncated form of this fold lacking one of the N-terminal strands
   automatically mapped to Pfam PF07828

6. Protein PA-IL, galactose-binding lectin 1 [82023] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [82024] (18 PDB entries)

8. Domain d4lk7a_: 4lk7 A: [228672]
   automated match to d1l7la_
   complexed with 04g, ca, gal

Details for d4lk7a_

PDB Entry: 4lk7, 1.76 Å

PDB Description: crystal structure of pseudomonas aeruginosa lectin leca complexed with resorufin-b-d-galactopyranoside at 1.76 a resolution

PDB Compounds: (A:) PA-I galactophilic lectin

SCOPe Domain Sequences for d4lk7a_:

Sequence; same for both SEQRES and ATOM records:

>d4lk7a_ b.18.1.16 (A:) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa [TaxId: 287]}
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
s

Timeline for d4lk7a_:

• d4lk7a_ first appeared in SCOPe 2.03
  
• d4lk7a_ appears in SCOPe 2.04
  
• d4lk7a_ appears in SCOPe 2.06
  
• d4lk7a_ appears in the current release, SCOPe 2.08