Lineage for d1fa4a_ (1fa4 A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 11048Protein Plastocyanin [49507] (14 species)
  7. 11049Species Anabaena variabilis [TaxId:1172] [49517] (2 PDB entries)
  8. 11051Domain d1fa4a_: 1fa4 A: [22867]

Details for d1fa4a_

PDB Entry: 1fa4 (more details)

PDB Description: elucidation of the paramagnetic relaxation of heteronuclei and protons in cu(ii) plastocyanin from anabaena variabilis

SCOP Domain Sequences for d1fa4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fa4a_ b.6.1.1 (A:) Plastocyanin {Anabaena variabilis}
etytvklgsdkgllvfepakltikpgdtveflnnkvpphnvvfdaalnpaksadlaksls
hkqllmspgqststtfpadapageytfycephrgagmvgkitvag

SCOP Domain Coordinates for d1fa4a_:

Click to download the PDB-style file with coordinates for d1fa4a_.
(The format of our PDB-style files is described here.)

Timeline for d1fa4a_: