| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.16: PA-IL, galactose-binding lectin 1 [82022] (1 protein) a truncated form of this fold lacking one of the N-terminal strands automatically mapped to Pfam PF07828 |
| Protein PA-IL, galactose-binding lectin 1 [82023] (1 species) |
| Species Pseudomonas aeruginosa [TaxId:287] [82024] (21 PDB entries) |
| Domain d4ljha_: 4ljh A: [228667] automated match to d3zyha_ complexed with ca, gal, mhd |
PDB Entry: 4ljh (more details), 1.45 Å
SCOPe Domain Sequences for d4ljha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ljha_ b.18.1.16 (A:) PA-IL, galactose-binding lectin 1 {Pseudomonas aeruginosa [TaxId: 287]}
awkgevlanneagqvtsiiynpgdvitivaagwasygptqkwgpqgdrehpdqglichda
fcgalvmkignsgtipvntglfrwvapnnvqgaitliyndvpgtygnnsgsfsvnigkdq
s
Timeline for d4ljha_: