SCOPe 2.07: Domain d4lcuc_: 4lcu C:

Lineage for d4lcuc_ (4lcu C:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families)
   Pfam PF00520

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (3 species)

7. Species Streptomyces lividans [TaxId:1916] [161074] (28 PDB entries)

8. Domain d4lcuc_: 4lcu C: [228665]
   Other proteins in same PDB: d4lcua1, d4lcua2, d4lcua3, d4lcub1, d4lcub2
   automated match to d1r3jc_
   complexed with dga, k; mutant

Details for d4lcuc_

PDB Entry: 4lcu, 2.75 Å

PDB Description: structure of kcsa with e118a mutation

PDB Compounds: (C:) pH-gated potassium channel KcsA

SCOPe Domain Sequences for d4lcuc_:

Sequence; same for both SEQRES and ATOM records:

>d4lcuc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrlvavvvmvagitsfglvtaalatwfvgraqerrg

Timeline for d4lcuc_:

• d4lcuc_ first appeared in SCOPe 2.03
  
• d4lcuc_ appears in SCOPe 2.06
  
• d4lcuc_ appears in the current release, SCOPe 2.08