Lineage for d1nin__ (1nin -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 11048Protein Plastocyanin [49507] (14 species)
  7. 11049Species Anabaena variabilis [TaxId:1172] [49517] (2 PDB entries)
  8. 11050Domain d1nin__: 1nin - [22866]

Details for d1nin__

PDB Entry: 1nin (more details)

PDB Description: plastocyanin from anabaena variabilis, nmr, 20 structures

SCOP Domain Sequences for d1nin__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nin__ b.6.1.1 (-) Plastocyanin {Anabaena variabilis}
etytvklgsdkgllvfepakltikpgdtveflnnkvpphnvvfdaalnpaksadlaksls
hkqllmspgqststtfpadapageytfycephrgagmvgkitvag

SCOP Domain Coordinates for d1nin__:

Click to download the PDB-style file with coordinates for d1nin__.
(The format of our PDB-style files is described here.)

Timeline for d1nin__: