Lineage for d4jmua_ (4jmu A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2716789Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 2716790Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 2716791Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins)
    automatically mapped to Pfam PF00540
  6. 2716825Protein automated matches [228657] (4 species)
    not a true protein
  7. 2716830Species Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId:11698] [228658] (1 PDB entry)
  8. 2716831Domain d4jmua_: 4jmu A: [228659]
    automated match to d1tama_
    complexed with 1ml, so4

Details for d4jmua_

PDB Entry: 4jmu (more details), 2 Å

PDB Description: Crystal structure of HIV matrix residues 1-111 in complex with inhibitor
PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d4jmua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jmua_ a.61.1.1 (A:) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
svlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgqlq
pslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnk

SCOPe Domain Coordinates for d4jmua_:

Click to download the PDB-style file with coordinates for d4jmua_.
(The format of our PDB-style files is described here.)

Timeline for d4jmua_: