SCOPe 2.08: Domain d4jmua_: 4jmu A:

Lineage for d4jmua_ (4jmu A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins)
   automatically mapped to Pfam PF00540

6. Protein automated matches [228657] (4 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId:11698] [228658] (1 PDB entry)

8. Domain d4jmua_: 4jmu A: [228659]
   automated match to d1tama_
   complexed with 1ml, so4

Details for d4jmua_

PDB Entry: 4jmu, 2 Å

PDB Description: Crystal structure of HIV matrix residues 1-111 in complex with inhibitor

PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d4jmua_:

Sequence; same for both SEQRES and ATOM records:

>d4jmua_ a.61.1.1 (A:) automated matches {Human immunodeficiency virus type 1 (new york-5 isolate) [TaxId: 11698]}
svlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgqlq
pslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnk

Timeline for d4jmua_:

• d4jmua_ first appeared in SCOPe 2.03
  
• d4jmua_ appears in SCOPe 2.07