Lineage for d4i0ta1 (4i0t A:363-635)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2220835Protein Tyrosine-protein kinase SYK [118131] (1 species)
    PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase
  7. 2220836Species Human (Homo sapiens) [TaxId:9606] [118132] (60 PDB entries)
    Uniprot P43405 363-635 # structure of the SH2 domain tandem region (9-265) is also known (55576)
  8. 2220854Domain d4i0ta1: 4i0t A:363-635 [228654]
    Other proteins in same PDB: d4i0ta2
    automated match to d1xbba_
    complexed with 1b6

Details for d4i0ta1

PDB Entry: 4i0t (more details), 1.7 Å

PDB Description: crystal structure of spleen tyrosine kinase complexed with 2-(5,6,7,8- tetrahydro-imidazo[1,5-a]pyridin-1-yl)-5h-pyrrolo[2,3-b]pyrazine-7- carboxylic acid tert-butylamide
PDB Compounds: (A:) Tyrosine-protein kinase SYK

SCOPe Domain Sequences for d4i0ta1:

Sequence, based on SEQRES records: (download)

>d4i0ta1 d.144.1.7 (A:363-635) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaean
vmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgm
kyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyape
cinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremy
dlmnlcwtydvenrpgfaavelrlrnyyydvvn

Sequence, based on observed residues (ATOM records): (download)

>d4i0ta1 d.144.1.7 (A:363-635) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilpalkdellaeanvmqqld
npyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkylees
nfvhrdlaarnvllvtqhyakisdfglskalradenyykawpvkwyapecinyykfssks
dvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwtydv
enrpgfaavelrlrnyyydvvn

SCOPe Domain Coordinates for d4i0ta1:

Click to download the PDB-style file with coordinates for d4i0ta1.
(The format of our PDB-style files is described here.)

Timeline for d4i0ta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i0ta2