Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (57 species) not a true protein |
Species Escherichia coli K-12 [TaxId:83333] [225713] (14 PDB entries) |
Domain d4i01a2: 4i01 A:139-207 [228649] Other proteins in same PDB: d4i01a1, d4i01b1 automated match to d1hw5a1 complexed with cmp; mutant |
PDB Entry: 4i01 (more details), 2.3 Å
SCOPe Domain Sequences for d4i01a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i01a2 a.4.5.0 (A:139-207) automated matches {Escherichia coli K-12 [TaxId: 83333]} dltgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgrilkmledqnlis ahgktivvy
Timeline for d4i01a2: