| Class b: All beta proteins [48724] (180 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
| Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
| Protein automated matches [190352] (10 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [225712] (8 PDB entries) |
| Domain d4i01a1: 4i01 A:6-138 [228648] Other proteins in same PDB: d4i01a2, d4i01b2 automated match to d1hw5a2 complexed with cmp; mutant |
PDB Entry: 4i01 (more details), 2.3 Å
SCOPe Domain Sequences for d4i01a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i01a1 b.82.3.2 (A:6-138) automated matches {Escherichia coli K-12 [TaxId: 83333]}
pqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsyl
nqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrl
qvtsekvgnlafl
Timeline for d4i01a1: