SCOPe 2.08: Domain d4i0aa1: 4i0a A:8-138

Lineage for d4i0aa1 (4i0a A:8-138)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein automated matches [190352] (10 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [225712] (8 PDB entries)

8. Domain d4i0aa1: 4i0a A:8-138 [228640]
   Other proteins in same PDB: d4i0aa2, d4i0ab2
   automated match to d1hw5a2
   complexed with cmp, gol; mutant

Details for d4i0aa1

PDB Entry: 4i0a, 2.2 Å

PDB Description: structure of the mutant Catabolite gene activator protein V132A

PDB Compounds: (A:) Catabolite gene activator

SCOPe Domain Sequences for d4i0aa1:

Sequence; same for both SEQRES and ATOM records:

>d4i0aa1 b.82.3.2 (A:8-138) automated matches {Escherichia coli K-12 [TaxId: 83333]}
tdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnq
gdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqv
tsekagnlafl

Timeline for d4i0aa1:

• d4i0aa1 first appeared in SCOPe 2.03
  
• d4i0aa1 appears in SCOPe 2.07