Lineage for d1kdj__ (1kdj -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (4 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins) 
Protein Plastocyanin [49507] (14 species) 
Species Fern (Adiantum capillus-veneris) [TaxId:13818] [49516] (2 PDB entries) 
Domain d1kdj__: 1kdj - [22864]
Details for d1kdj__
PDB Entry: 1kdj (more details), 1.7 Å
PDB Description: oxidized form of plastocyanin from dryopteris crassirhizoma
SCOP Domain Sequences for d1kdj__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kdj__ b.6.1.1 (-) Plastocyanin {Fern (Adiantum capillus-veneris)}
akvevgdevgnfkfypdsitvsageaveftlvgetghnivfdipagapgtvaselkaasm
dendllsedepsfkakvstpgtytfyctphksanmkgtltvk
SCOP Domain Coordinates for d1kdj__:
Click to download the PDB-style file with coordinates for d1kdj__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1kdj__:
- d1kdj__ first appeared (with stable ids) in SCOP 1.55
- d1kdj__ appears in SCOP 1.59
- d1kdj__ appears in the current release, SCOPe 2.08, called d1kdja_
View in 3D