Class b: All beta proteins [48724] (180 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein Plastocyanin [49507] (17 species) |
Species Fern (Adiantum capillus-veneris) [TaxId:13818] [49516] (2 PDB entries) |
Domain d1kdja_: 1kdj A: [22864] complexed with cu |
PDB Entry: 1kdj (more details), 1.7 Å
SCOPe Domain Sequences for d1kdja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} akvevgdevgnfkfypdsitvsageaveftlvgetghnivfdipagapgtvaselkaasm dendllsedepsfkakvstpgtytfyctphksanmkgtltvk
Timeline for d1kdja_: