Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (87 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:273057] [228633] (1 PDB entry) |
Domain d4hw0a_: 4hw0 A: [228634] automated match to d1r7ja_ |
PDB Entry: 4hw0 (more details), 2 Å
SCOPe Domain Sequences for d4hw0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hw0a_ a.4.5.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 273057]} krgtmeimfdilrncepkcgitrviygaginyvvaqkyldqlvkvgalniktendrkiye itekgkllrthieefikirenlysakekvsellrtdse
Timeline for d4hw0a_: