SCOPe 2.08: Domain d4hncb2: 4hnc B:133-359

Lineage for d4hncb2 (4hnc B:133-359)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)

6. Protein automated matches [226997] (13 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [228631] (7 PDB entries)

8. Domain d4hncb2: 4hnc B:133-359 [228632]
   Other proteins in same PDB: d4hnca1, d4hncb1
   automated match to d1dtna1
   complexed with 0ut, mg

Details for d4hncb2

PDB Entry: 4hnc, 1.89 Å

PDB Description: p. putida c92s/k166c/c264s mandelate racemase co-crystallized with benzilic acid

PDB Compounds: (B:) mandelate racemase

SCOPe Domain Sequences for d4hncb2:

Sequence; same for both SEQRES and ATOM records:

>d4hncb2 c.1.11.2 (B:133-359) automated matches {Pseudomonas putida [TaxId: 303]}
pvqaydshsldgvklateravtaaelgfravktcigypaldqdlavvrsirqavgddfgi
mvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvpvqmgenwlgp
eemfkalsigasrlampdamkiggvtgwirasalaqqfgipmsshlfqeisahllaatpt
ahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv

Timeline for d4hncb2:

• d4hncb2 first appeared in SCOPe 2.03
  
• d4hncb2 appears in SCOPe 2.07