Lineage for d4hm0a2 (4hm0 A:155-448)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975670Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 2975702Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (5 species)
  7. 2975720Species Pseudomonas sp. [TaxId:69011] [228600] (14 PDB entries)
  8. 2975734Domain d4hm0a2: 4hm0 A:155-448 [228627]
    Other proteins in same PDB: d4hm0a1, d4hm0b_
    automated match to d1o7na2
    complexed with edo, fe, fes, iac, so4

Details for d4hm0a2

PDB Entry: 4hm0 (more details), 1.8 Å

PDB Description: Naphthalene 1,2-Dioxygenase bound to indole-3-acetate
PDB Compounds: (A:) Naphthalene 1,2-dioxygenase subunit alpha

SCOPe Domain Sequences for d4hm0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hm0a2 d.129.3.3 (A:155-448) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas sp. [TaxId: 69011]}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltkttd

SCOPe Domain Coordinates for d4hm0a2:

Click to download the PDB-style file with coordinates for d4hm0a2.
(The format of our PDB-style files is described here.)

Timeline for d4hm0a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hm0a1
View in 3D
Domains from other chains:
(mouse over for more information)
d4hm0b_