| Class b: All beta proteins [48724] (180 folds) |
| Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) ![]() |
| Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins) |
| Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (4 species) |
| Species Pseudomonas sp. [TaxId:69011] [228594] (13 PDB entries) |
| Domain d4hm0a1: 4hm0 A:1-154 [228626] Other proteins in same PDB: d4hm0a2, d4hm0b_ automated match to d1o7na1 complexed with edo, fe, fes, iac, so4 |
PDB Entry: 4hm0 (more details), 1.8 Å
SCOPe Domain Sequences for d4hm0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hm0a1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas sp. [TaxId: 69011]}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq
Timeline for d4hm0a1: