Lineage for d4hm7a1 (4hm7 A:1-154)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782462Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)
  6. 2782494Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (4 species)
  7. 2782512Species Pseudomonas sp. [TaxId:69011] [228594] (13 PDB entries)
  8. 2782517Domain d4hm7a1: 4hm7 A:1-154 [228624]
    Other proteins in same PDB: d4hm7a2, d4hm7b_
    automated match to d1o7na1
    complexed with edo, fe, fes, so4, syn

Details for d4hm7a1

PDB Entry: 4hm7 (more details), 1.5 Å

PDB Description: Naphthalene 1,2-Dioxygenase bound to styrene
PDB Compounds: (A:) Naphthalene 1,2-dioxygenase subunit alpha

SCOPe Domain Sequences for d4hm7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hm7a1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas sp. [TaxId: 69011]}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

SCOPe Domain Coordinates for d4hm7a1:

Click to download the PDB-style file with coordinates for d4hm7a1.
(The format of our PDB-style files is described here.)

Timeline for d4hm7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hm7a2
View in 3D
Domains from other chains:
(mouse over for more information)
d4hm7b_