SCOPe 2.05: Domain d4hm6a2: 4hm6 A:155-446

Lineage for d4hm6a2 (4hm6 A:155-446)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins)
   Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1

6. Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (5 species)

7. Species Pseudomonas sp. [TaxId:69011] [228600] (14 PDB entries)

8. Domain d4hm6a2: 4hm6 A:155-446 [228622]
   Other proteins in same PDB: d4hm6a1, d4hm6b_
   automated match to d1o7na2
   complexed with 16q, edo, fe, fes, so4

Details for d4hm6a2

PDB Entry: 4hm6, 1.5 Å

PDB Description: Naphthalene 1,2-Dioxygenase bound to phenetole

PDB Compounds: (A:) Naphthalene 1,2-dioxygenase subunit alpha

SCOPe Domain Sequences for d4hm6a2:

Sequence; same for both SEQRES and ATOM records:

>d4hm6a2 d.129.3.3 (A:155-446) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas sp. [TaxId: 69011]}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtfgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltkt

Timeline for d4hm6a2:

• d4hm6a2 first appeared in SCOPe 2.03
  
• d4hm6a2 appears in SCOPe 2.04
  
• d4hm6a2 appears in SCOPe 2.06
  
• d4hm6a2 appears in the current release, SCOPe 2.08