SCOPe 2.07: Domain d4hm7b_: 4hm7 B:

Lineage for d4hm7b_ (4hm7 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
   Pfam PF00866

6. Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species)

7. Species Pseudomonas sp. [TaxId:69011] [228596] (10 PDB entries)

8. Domain d4hm7b_: 4hm7 B: [228620]
   Other proteins in same PDB: d4hm7a1, d4hm7a2
   automated match to d1o7nb_
   complexed with edo, fe, fes, so4, syn

Details for d4hm7b_

PDB Entry: 4hm7, 1.5 Å

PDB Description: Naphthalene 1,2-Dioxygenase bound to styrene

PDB Compounds: (B:) Naphthalene 1,2-dioxygenase subunit beta

SCOPe Domain Sequences for d4hm7b_:

Sequence; same for both SEQRES and ATOM records:

>d4hm7b_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas sp. [TaxId: 69011]}
iniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgsev
qyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfitn
vqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdype
rilqthnlmvfl

Timeline for d4hm7b_:

• d4hm7b_ first appeared in SCOPe 2.03
  
• d4hm7b_ appears in SCOPe 2.06
  
• d4hm7b_ appears in the current release, SCOPe 2.08