Lineage for d4hm7b_ (4hm7 B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180921Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2181455Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2181740Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
    Pfam PF00866
  6. 2181752Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species)
  7. 2181774Species Pseudomonas sp. [TaxId:69011] [228596] (10 PDB entries)
  8. 2181778Domain d4hm7b_: 4hm7 B: [228620]
    Other proteins in same PDB: d4hm7a1, d4hm7a2
    automated match to d1o7nb_
    complexed with edo, fe, fes, so4, syn

Details for d4hm7b_

PDB Entry: 4hm7 (more details), 1.5 Å

PDB Description: Naphthalene 1,2-Dioxygenase bound to styrene
PDB Compounds: (B:) Naphthalene 1,2-dioxygenase subunit beta

SCOPe Domain Sequences for d4hm7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hm7b_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas sp. [TaxId: 69011]}
iniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgsev
qyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfitn
vqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdype
rilqthnlmvfl

SCOPe Domain Coordinates for d4hm7b_:

Click to download the PDB-style file with coordinates for d4hm7b_.
(The format of our PDB-style files is described here.)

Timeline for d4hm7b_: