SCOPe 2.05: Domain d4hm1b_: 4hm1 B:

Lineage for d4hm1b_ (4hm1 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.4: Ring hydroxylating beta subunit [54438] (7 proteins)
   Pfam PF00866

6. Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (4 species)

7. Species Pseudomonas sp. [TaxId:69011] [228596] (10 PDB entries)

8. Domain d4hm1b_: 4hm1 B: [228611]
   Other proteins in same PDB: d4hm1a1, d4hm1a2
   automated match to d1o7nb_
   complexed with 1on, edo, fe, fes, so4

Details for d4hm1b_

PDB Entry: 4hm1, 1.5 Å

PDB Description: Naphthalene 1,2-Dioxygenase bound to 1-indanone

PDB Compounds: (B:) Naphthalene 1,2-dioxygenase subunit beta

SCOPe Domain Sequences for d4hm1b_:

Sequence; same for both SEQRES and ATOM records:

>d4hm1b_ d.17.4.4 (B:) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas sp. [TaxId: 69011]}
iniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgsev
qyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfitn
vqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdype
rilqthnlmvfl

Timeline for d4hm1b_:

• d4hm1b_ first appeared in SCOPe 2.03
  
• d4hm1b_ appears in SCOPe 2.04
  
• d4hm1b_ appears in SCOPe 2.06
  
• d4hm1b_ appears in the current release, SCOPe 2.08