SCOPe 2.01: Domain d1iuza_: 1iuz A:

Lineage for d1iuza_ (1iuz A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (16 species)

7. Species Ulva pertusa, a sea lettuce [TaxId:3120] [49513] (1 PDB entry)

8. Domain d1iuza_: 1iuz A: [22861]
   complexed with cu, so4

Details for d1iuza_

PDB Entry: 1iuz, 1.6 Å

PDB Description: plastocyanin

PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d1iuza_:

Sequence; same for both SEQRES and ATOM records:

>d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]}
aqivklggddgslafvpskisvaageaiefvnnagfphnivfdedavpagvdadaisydd
ylnskgetvvrklstpgvygvycephagagmkmtitvq

Timeline for d1iuza_:

• d1iuza_ first appeared (with stable ids) in SCOP 1.55, called d1iuz__
  
• d1iuza_ appears in SCOP 1.75
  
• d1iuza_ appears in SCOPe 2.02
  
• d1iuza_ appears in the current release, SCOPe 2.08