Lineage for d1iuz__ (1iuz -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 55932Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 55933Superfamily b.6.1: Cupredoxins [49503] (4 families) (S)
  5. 55934Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
  6. 56083Protein Plastocyanin [49507] (14 species)
  7. 56124Species Sea lettuce (Ulva pertusa) [49513] (1 PDB entry)
  8. 56125Domain d1iuz__: 1iuz - [22861]

Details for d1iuz__

PDB Entry: 1iuz (more details), 1.6 Å

PDB Description: plastocyanin

SCOP Domain Sequences for d1iuz__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iuz__ b.6.1.1 (-) Plastocyanin {Sea lettuce (Ulva pertusa)}
aqivklggddgslafvpskisvaageaiefvnnagfphnivfdedavpagvdadaisydd
ylnskgetvvrklstpgvygvycephagagmkmtitvq

SCOP Domain Coordinates for d1iuz__:

Click to download the PDB-style file with coordinates for d1iuz__.
(The format of our PDB-style files is described here.)

Timeline for d1iuz__: