Lineage for d1iuz__ (1iuz -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.6: Cupredoxins [49502] (1 superfamily) Superfamily b.6.1: Cupredoxins [49503] (3 families) 
Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins) 
Protein Plastocyanin [49507] (14 species) 
Species Sea lettuce (Ulva pertusa) [49513] (1 PDB entry) 
Domain d1iuz__: 1iuz - [22861]
Details for d1iuz__
PDB Entry: 1iuz (more details), 1.6 Å
PDB Description: plastocyanin
SCOP Domain Sequences for d1iuz__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iuz__ b.6.1.1 (-) Plastocyanin {Sea lettuce (Ulva pertusa)}
aqivklggddgslafvpskisvaageaiefvnnagfphnivfdedavpagvdadaisydd
ylnskgetvvrklstpgvygvycephagagmkmtitvq
SCOP Domain Coordinates for d1iuz__:
Click to download the PDB-style file with coordinates for d1iuz__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iuz__:
- d1iuz__ appears in SCOP 1.57
- d1iuz__ appears in the current release, SCOPe 2.08, called d1iuza_
View in 3D