SCOPe 2.08: Domain d1byob_: 1byo B:

Lineage for d1byob_ (1byo B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (17 species)

7. Species White campion (Silene pratensis) [TaxId:52853] [49512] (2 PDB entries)

8. Domain d1byob_: 1byo B: [22860]
   complexed with cu

Details for d1byob_

PDB Entry: 1byo, 2 Å

PDB Description: wild-type plastocyanin from silene

PDB Compounds: (B:) protein (plastocyanin)

SCOPe Domain Sequences for d1byob_:

Sequence; same for both SEQRES and ATOM records:

>d1byob_ b.6.1.1 (B:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]}
aevllgssdgglafvpsdlsiasgekitfknnagfphndlfdedevpagvdvtkismpee
dllnapgeeysvtltekgtykfycaphagagmvgkvtvn

Timeline for d1byob_:

• d1byob_ first appeared (with stable ids) in SCOP 1.55
  
• d1byob_ appears in SCOPe 2.07