| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
| Protein Plastocyanin [49507] (17 species) |
| Species White campion (Silene pratensis) [TaxId:52853] [49512] (2 PDB entries) |
| Domain d1byob_: 1byo B: [22860] complexed with cu |
PDB Entry: 1byo (more details), 2 Å
SCOPe Domain Sequences for d1byob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1byob_ b.6.1.1 (B:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]}
aevllgssdgglafvpsdlsiasgekitfknnagfphndlfdedevpagvdvtkismpee
dllnapgeeysvtltekgtykfycaphagagmvgkvtvn
Timeline for d1byob_: