Lineage for d1byoa_ (1byo A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 10904Fold b.6: Cupredoxins [49502] (1 superfamily)
  4. 10905Superfamily b.6.1: Cupredoxins [49503] (3 families) (S)
  5. 10906Family b.6.1.1: Plastocyanin/azurin-like [49504] (7 proteins)
  6. 11048Protein Plastocyanin [49507] (14 species)
  7. 11091Species White campion (Silene pratensis) [TaxId:52853] [49512] (2 PDB entries)
  8. 11093Domain d1byoa_: 1byo A: [22859]

Details for d1byoa_

PDB Entry: 1byo (more details), 2 Å

PDB Description: wild-type plastocyanin from silene

SCOP Domain Sequences for d1byoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1byoa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis)}
aevllgssdgglafvpsdlsiasgekitfknnagfphndlfdedevpagvdvtkismpee
dllnapgeeysvtltekgtykfycaphagagmvgkvtvn

SCOP Domain Coordinates for d1byoa_:

Click to download the PDB-style file with coordinates for d1byoa_.
(The format of our PDB-style files is described here.)

Timeline for d1byoa_: