![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (94 species) not a true protein |
![]() | Species Agrobacterium tumefaciens [TaxId:176299] [226505] (8 PDB entries) |
![]() | Domain d4hcda1: 4hcd A:2-126 [228589] Other proteins in same PDB: d4hcda2, d4hcda3 automated match to d4hcha1 complexed with cl, mg, na |
PDB Entry: 4hcd (more details), 1.7 Å
SCOPe Domain Sequences for d4hcda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hcda1 d.54.1.0 (A:2-126) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} iitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivrphv iekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgqpvy kligg
Timeline for d4hcda1: