SCOPe 2.06: Domain d4hcda1: 4hcd A:2-126

Lineage for d4hcda1 (4hcd A:2-126)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [226505] (8 PDB entries)

8. Domain d4hcda1: 4hcd A:2-126 [228589]
   Other proteins in same PDB: d4hcda2, d4hcda3
   automated match to d4hcha1
   complexed with cl, mg, na

Details for d4hcda1

PDB Entry: 4hcd, 1.7 Å

PDB Description: Crystal structure of D-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium

PDB Compounds: (A:) isomerase/lactonizing enzyme

SCOPe Domain Sequences for d4hcda1:

Sequence; same for both SEQRES and ATOM records:

>d4hcda1 d.54.1.0 (A:2-126) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
iitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivrphv
iekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgqpvy
kligg

Timeline for d4hcda1:

• d4hcda1 first appeared in SCOPe 2.03
  
• d4hcda1 appears in SCOPe 2.05
  
• d4hcda1 appears in SCOPe 2.07
  
• d4hcda1 appears in the current release, SCOPe 2.08