Lineage for d4hcda1 (4hcd A:2-126)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2947900Species Agrobacterium tumefaciens [TaxId:176299] [226505] (8 PDB entries)
  8. 2947911Domain d4hcda1: 4hcd A:2-126 [228589]
    Other proteins in same PDB: d4hcda2, d4hcda3
    automated match to d4hcha1
    complexed with cl, mg, na

Details for d4hcda1

PDB Entry: 4hcd (more details), 1.7 Å

PDB Description: Crystal structure of D-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium
PDB Compounds: (A:) isomerase/lactonizing enzyme

SCOPe Domain Sequences for d4hcda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hcda1 d.54.1.0 (A:2-126) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
iitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivrphv
iekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgqpvy
kligg

SCOPe Domain Coordinates for d4hcda1:

Click to download the PDB-style file with coordinates for d4hcda1.
(The format of our PDB-style files is described here.)

Timeline for d4hcda1: