| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Listeria monocytogenes [TaxId:169963] [225327] (8 PDB entries) |
| Domain d4cc4e2: 4cc4 E:220-297 [228588] Other proteins in same PDB: d4cc4a1, d4cc4a3, d4cc4b1, d4cc4b2, d4cc4b3, d4cc4c1, d4cc4c3, d4cc4c4, d4cc4d1, d4cc4d2, d4cc4e1, d4cc4f1, d4cc4f2, d4cc4f3 automated match to d2omza1 complexed with cl, gol, pe4, po4, so4 |
PDB Entry: 4cc4 (more details), 2.6 Å
SCOPe Domain Sequences for d4cc4e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cc4e2 b.1.18.0 (E:220-297) automated matches {Listeria monocytogenes [TaxId: 169963]}
nepvkyqpelyitntvkdpdgrwispaaisnggsyvdgcvlwelpvytdevsykfseyin
vgeteaifdgtvtqpikn
Timeline for d4cc4e2: