Lineage for d4cc4e2 (4cc4 E:220-297)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766372Species Listeria monocytogenes [TaxId:169963] [225327] (8 PDB entries)
  8. 2766388Domain d4cc4e2: 4cc4 E:220-297 [228588]
    Other proteins in same PDB: d4cc4a1, d4cc4a3, d4cc4b1, d4cc4b2, d4cc4b3, d4cc4c1, d4cc4c3, d4cc4c4, d4cc4d1, d4cc4d2, d4cc4e1, d4cc4f1, d4cc4f2, d4cc4f3
    automated match to d2omza1
    complexed with cl, gol, pe4, po4, so4

Details for d4cc4e2

PDB Entry: 4cc4 (more details), 2.6 Å

PDB Description: complex of inlc of listeria monocytogenes and human tuba c-terminal sh3 domain
PDB Compounds: (E:) inlc protein

SCOPe Domain Sequences for d4cc4e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cc4e2 b.1.18.0 (E:220-297) automated matches {Listeria monocytogenes [TaxId: 169963]}
nepvkyqpelyitntvkdpdgrwispaaisnggsyvdgcvlwelpvytdevsykfseyin
vgeteaifdgtvtqpikn

SCOPe Domain Coordinates for d4cc4e2:

Click to download the PDB-style file with coordinates for d4cc4e2.
(The format of our PDB-style files is described here.)

Timeline for d4cc4e2: