SCOPe 2.08: Domain d4cc4e1: 4cc4 E:35-219

Lineage for d4cc4e1 (4cc4 E:35-219)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.2: L domain-like [52058] (9 families)
   less regular structure consisting of variable repeats

5. Family c.10.2.0: automated matches [191489] (1 protein)
   not a true family

6. Protein automated matches [190787] (14 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:169963] [228586] (2 PDB entries)

8. Domain d4cc4e1: 4cc4 E:35-219 [228587]
   Other proteins in same PDB: d4cc4a2, d4cc4a3, d4cc4b1, d4cc4b2, d4cc4b3, d4cc4c2, d4cc4c3, d4cc4c4, d4cc4d1, d4cc4d2, d4cc4e2, d4cc4f1, d4cc4f2, d4cc4f3
   automated match to d2omza2
   complexed with cl, gol, pe4, po4, so4

Details for d4cc4e1

PDB Entry: 4cc4, 2.6 Å

PDB Description: complex of inlc of listeria monocytogenes and human tuba c-terminal sh3 domain

PDB Compounds: (E:) inlc protein

SCOPe Domain Sequences for d4cc4e1:

Sequence; same for both SEQRES and ATOM records:

>d4cc4e1 c.10.2.0 (E:35-219) automated matches {Listeria monocytogenes [TaxId: 169963]}
esiqrptpinqvfpdpglanavkqnlgkqsvtdlvsqkelsgvqnfngdnsniqslagmq
fftnlkelhlshnqisdlsplkdltkleelsvnrnrlknlngipsaclsrlfldnnelrd
tdslihlknleilsirnnklksivmlgflsklevldlhgneitntggltrlkkvnwidlt
gqkcv

Timeline for d4cc4e1:

• d4cc4e1 first appeared in SCOPe 2.03
  
• d4cc4e1 appears in SCOPe 2.07