Lineage for d4cc4f1 (4cc4 F:1513-1577)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783437Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)
  8. 2783544Domain d4cc4f1: 4cc4 F:1513-1577 [228585]
    Other proteins in same PDB: d4cc4a1, d4cc4a2, d4cc4a3, d4cc4b2, d4cc4b3, d4cc4c1, d4cc4c2, d4cc4c3, d4cc4c4, d4cc4d2, d4cc4e1, d4cc4e2, d4cc4f2, d4cc4f3
    automated match to d2xmfa_
    complexed with cl, gol, pe4, po4, so4

Details for d4cc4f1

PDB Entry: 4cc4 (more details), 2.6 Å

PDB Description: complex of inlc of listeria monocytogenes and human tuba c-terminal sh3 domain
PDB Compounds: (F:) Dynamin-binding protein

SCOPe Domain Sequences for d4cc4f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cc4f1 b.34.2.0 (F:1513-1577) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egnqvyfavytfkarnpnelsvsanqklkilefkdvtgntewwlaevngkkgyvpsnyir
kteyt

SCOPe Domain Coordinates for d4cc4f1:

Click to download the PDB-style file with coordinates for d4cc4f1.
(The format of our PDB-style files is described here.)

Timeline for d4cc4f1: