SCOP 1.75: Domain d1bypa_: 1byp A:

Lineage for d1bypa_ (1byp A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (14 species)

7. Species White campion (Silene pratensis) [TaxId:52853] [49512] (2 PDB entries)

8. Domain d1bypa_: 1byp A: [22858]
   complexed with cu; mutant

Details for d1bypa_

PDB Entry: 1byp, 1.75 Å

PDB Description: e43k,d44k double mutant plastocyanin from silene

PDB Compounds: (A:) protein (plastocyanin)

SCOP Domain Sequences for d1bypa_:

Sequence; same for both SEQRES and ATOM records:

>d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]}
aevllgssdgglafvpsdlsiasgekitfknnagfphndlfdkkevpagvdvtkismpee
dllnapgeeysvtltekgtykfycaphagagmvgkvtvn

Timeline for d1bypa_:

• d1bypa_ first appeared (with stable ids) in SCOP 1.55
  
• d1bypa_ appears in SCOP 1.73
  
• d1bypa_ appears in SCOPe 2.01
  
• d1bypa_ appears in the current release, SCOPe 2.08